PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_005690_hemo.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 846aa    MW: 91613.4 Da    PI: 6.3178
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_005690_hemo.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.5e-21147202156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe++F+++++p++++r eL+kkl L++rqVk+WFqNrR+++k
  Bv1_005690_hemo.t1 147 KKRYHRHTPQQIQELESVFKECPHPDEKQRLELSKKLCLETRQVKFWFQNRRTQMK 202
                         688999***********************************************999 PP

2START1915.7e-603615861206
                         HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
               START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                         ela+ a++elvk+a+ +ep+W +       e++n +e+++++ +s +     +  ea+r++ +v+ ++  lve+l+d + +W e+++    
  Bv1_005690_hemo.t1 361 ELALGAMDELVKLAQTDEPLWLRNMdaggkEILNHEEYMRSINPSFGyksngFVPEASRETDMVIINSLALVETLMDAN-RWAEMFPgmia 450
                         57899*******************99****************9987799888999************************.*********** PP

                         EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
               START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                         +a+t++vissg      g+lqlm aelq+lsplvp R + f+R+++q+ +g+w++vdvS+d  ++ + s+ +v +++lpSg+++++++ng+
  Bv1_005690_hemo.t1 451 RASTTDVISSGmggtrnGVLQLMHAELQVLSPLVPvRVVNFLRFCKQHAEGVWAVVDVSIDCIRESSGSPTYVNCRRLPSGCVVQDMPNGY 541
                         *****************************************************************999*********************** PP

                         EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         skvtwveh++++++++h+l+r+l++ g+ +ga++w  tlqrqc++
  Bv1_005690_hemo.t1 542 SKVTWVEHAEYDESSIHQLYRPLISAGMGFGAQRWITTLQRQCQC 586
                         *******************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.45E-20133204IPR009057Homeodomain-like
PROSITE profilePS5007117.265144204IPR001356Homeobox domain
SMARTSM003893.7E-18145208IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.1E-22145212IPR009057Homeodomain-like
CDDcd000865.42E-19146204No hitNo description
PfamPF000461.3E-18147202IPR001356Homeobox domain
PROSITE patternPS000270179202IPR017970Homeobox, conserved site
PROSITE profilePS5084844.402352589IPR002913START domain
SuperFamilySSF559611.92E-31354586No hitNo description
CDDcd088757.25E-117356585No hitNo description
SMARTSM002345.7E-44361586IPR002913START domain
PfamPF018524.5E-52362586IPR002913START domain
SuperFamilySSF559611.32E-24614839No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 846 aa     Download sequence    Send to blast
MNFGGFLDSS GAGSDGGGSG GGASSARLVA DISYNHNHNN NNMSPAAISH SPHQHLQRLV  60
GPTSINKSFF NTPGLSLALQ TGMEGHGEVT KVTDQNYEGN NGNGGSGGSL GGVRRNREDE  120
HESRSGSDNL DGASGDDQDA ADLPPRKKRY HRHTPQQIQE LESVFKECPH PDEKQRLELS  180
KKLCLETRQV KFWFQNRRTQ MKTQLERHEN SILRQENDKL RAENMSIREA MRNPICTNCG  240
GQAMIGDISM EEQHLRIENA RLKDELDRVC TLASKFLGRP VSSLSTLTGS ISAPPMPSSS  300
LELAVGTNGF GPLTTVTTSS LPLAPDFGSG ISNALPVVSP TKSTANVSGI ERSFERSMYL  360
ELALGAMDEL VKLAQTDEPL WLRNMDAGGK EILNHEEYMR SINPSFGYKS NGFVPEASRE  420
TDMVIINSLA LVETLMDANR WAEMFPGMIA RASTTDVISS GMGGTRNGVL QLMHAELQVL  480
SPLVPVRVVN FLRFCKQHAE GVWAVVDVSI DCIRESSGSP TYVNCRRLPS GCVVQDMPNG  540
YSKVTWVEHA EYDESSIHQL YRPLISAGMG FGAQRWITTL QRQCQCLAIL MSSNIPSGDH  600
TAITASGRRS MLKLAQRMTN NFCAGVCAST VHKWNKLNVG NVDEDVQVMT RKSIDDPGEP  660
SGIVLSAATA VWLPVSPQRL FDFLRDERLR SEWDILSNGG PMQEMAHIAK GQDQGNCVSL  720
LRAGAMNPNQ SSMLILQETC TDASGSLVVY APVDIPAMHV VMNGGDSAYV ALLPSGFAIT  780
PDGPSTRGPN GNAGPQRVGG SLLSVAFQIL VNSLPTAKLT VESVETVNNL ISCTVQKIKA  840
ALNCES
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010671720.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0J8D4480.0A0A0J8D448_BETVU; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein